PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00025850-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 148aa    MW: 17182.7 Da    PI: 9.0783
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00025850-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.88.2e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien+snrqvt+skRrngi+KKA+E+SvLCda+v+++i++s+gk++ey+s
  WALNUT_00025850-RA  9 KRIENSSNRQVTYSKRRNGIIKKAKEISVLCDAKVSLVILGSSGKMHEYCS 59
                        79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.889161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.55E-32286IPR002100Transcription factor, MADS-box
CDDcd002651.63E-38276No hitNo description
PRINTSPR004043.5E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.5E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGIIK KAKEISVLCD AKVSLVILGS SGKMHEYCSP  60
STSLVDLLED YHKQSGKIRL WDAKHEEKIL EEENKHLNLI LHQQEIAMGT ISRDVADDYE  120
QRVIRDYNSQ MPFAFRVQPI QPNLQERM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-16260159Myocyte-specific enhancer factor 2A
3mu6_C1e-16260159Myocyte-specific enhancer factor 2A
3mu6_B1e-16260159Myocyte-specific enhancer factor 2A
3mu6_A1e-16260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011653776.15e-63PREDICTED: floral homeotic protein PMADS 2 isoform X2
SwissprotQ074743e-48MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A0B0P6C15e-73A0A0B0P6C1_G
STRINGGLYMA13G09660.12e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43553255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-43MIKC_MADS family protein